Structure of PDB 8gym Chain S6 |
>8gymS6 (length=92) Species: 312017 (Tetrahymena thermophila SB210) [Search protein sequence] |
NLNPYSYEALKENHWLVSDSSKKNSEWTHKSNAEQLIAKVPIIYVDSNIV RCIGGTEINAGHPQVYIQLDTRKHGTPQTCKYCGLRYAKKMD |
|
PDB | 8gym Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae. |
Chain | S6 |
Resolution | 2.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S6 |
C87 H97 C115 C118 |
C52 H62 C80 C83 |
|
|
|
|