Structure of PDB 8e73 Chain S6 |
>8e73S6 (length=71) Species: 157791 (Vigna radiata) [Search protein sequence] |
SNHTAKWMQDTSKKSPMELINEVPPIKVEGRIVACEGDTNPALGHPIEFI CLDLPEPAVCKYCGLRYVQDH |
|
PDB | 8e73 Plant-specific features of respiratory supercomplex I + III 2 from Vigna radiata. |
Chain | S6 |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S6 |
H75 C90 Y92 C93 |
H45 C60 Y62 C63 |
|
|
|
|