Structure of PDB 7tgh Chain S6 |
>7tghS6 (length=90) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] |
LNPYSYEALKENHWLVSDSSKKNSEWTHKSNAEQLIAKVPIIYVDSNIVR CIGGTEINAGHPQVYIQLDTRKHGTPQTCKYCGLRYAKKM |
|
PDB | 7tgh Structures of Tetrahymena 's respiratory chain reveal the diversity of eukaryotic core metabolism. |
Chain | S6 |
Resolution | 2.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
S6 |
C87 H97 C115 C118 |
C51 H61 C79 C82 |
|
|
|
|