Structure of PDB 4u50 Chain S6

Receptor sequence

>4u50S6 (length=226) Species: 559292 (Saccharomyces cerevisiae S288C)

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGA
IVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKE
DDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQA
QREAAAEYAQLLAKRLSERKAEKAEI

3D structure

• PDB: 4u50 ?
• Chain: S6
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S6	K2 N4 P8 Q13 T15 S53 N56 Q59 G60 F61 Q65 G66 V67 R72 C83 R87 R88 D89 G90 R92 R94 K95 S96 A107 V108 A110 K131 R132 L133 G134 K136 R137 N139 N140 K149 R154 I158 R159 R160 Y169 T170 K171 A172 P173 K174 I175 Q176 R177 V179 Q182 R183 L184 Q185 R186 K187 R188 R191 K194 V195 A198 Q201 R202	K2 N4 P8 Q13 T15 S53 N56 Q59 G60 F61 Q65 G66 V67 R72 C83 R87 R88 D89 G90 R92 R94 K95 S96 A107 V108 A110 K131 R132 L133 G134 K136 R137 N139 N140 K149 R154 I158 R159 R160 Y169 T170 K171 A172 P173 K174 I175 Q176 R177 V179 Q182 R183 L184 Q185 R186 K187 R188 R191 K194 V195 A198 Q201 R202

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u50, PDBe:4u50, PDBj:4u50
• PDBsum: 4u50
• PubMed: 25209664
• UniProt: P0CX37|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)