Structure of PDB 3j77 Chain S6

Receptor sequence

>3j77S6 (length=226) Species: 4932 (Saccharomyces cerevisiae)

MKLNISYPVNGSQKTFEIDDEHRIRVFFDKRIGQEVDGEAVGDEFKGYVF
KISGGNDKQGFPMKQGVLLPTRIKLLLTKNVSCYRPRRDGERKRKSVRGA
IVGPDLAVLALVIVKKGEQELEGLTDTTVPKRLGPKRANNIRKFFGLSKE
DDVRDFVIRREVTKGEKTYTKAPKIQRLVTPQRLQRKRHQRALKVRNAQA
QREAAAEYAQLLAKRLSERKAEKAEI

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: S6
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S6	N4 Q13 T15 N56 Q59 G60 Q65 G66 C83 R85 R87 R88 R92 K93 R94 V108 R132 L133 G134 K136 R137 N139 N140 R160 V162 K171 P173 K174 Q176 R177 Q185 K187 R188 Q190 R191 A192 K194 A198 Q201 R202	N4 Q13 T15 N56 Q59 G60 Q65 G66 C83 R85 R87 R88 R92 K93 R94 V108 R132 L133 G134 K136 R137 N139 N140 R160 V162 K171 P173 K174 Q176 R177 Q185 K187 R188 Q190 R191 A192 K194 A198 Q201 R202

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P0CX37|RS6A_YEAST Small ribosomal subunit protein eS6A (Gene Name=RPS6A)