Structure of PDB 3j77 Chain S5

Receptor sequence

>3j77S5 (length=206) Species: 4932 (Saccharomyces cerevisiae)

FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: S5
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S5	H72 A78 K80 R81 N95 L97 M98 M99 G101 R102 N103 N104 G105 K106 K107 K109 R112 I113 R166 N169 F184 R185 N186 I187	H53 A59 K61 R62 N76 L78 M79 M80 G82 R83 N84 N85 G86 K87 K88 K90 R93 I94 R147 N150 F165 R166 N167 I168

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006450 regulation of translational fidelity
• GO:0030490 maturation of SSU-rRNA

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P26783|RS5_YEAST Small ribosomal subunit protein uS7 (Gene Name=RPS5)