Structure of PDB 3j6y Chain S5

Receptor sequence
>3j6yS5 (length=206) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
FTPVVLATPIPEEVQQAQTEIKLFNKWSFEEVEVKDASLVDYVQVRQPIF
VAHTAGRYANKRFRKAQCPIIERLTNSLMMNGRNNGKKLKAVRIIKHTLD
IINVLTDQNPIQVVVDAITNTGPREDTTRVGGGGAARRQAVDVSPLRRVN
QAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELER
VAKSNR
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
ChainS5
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S5 H72 K80 R81 R92 N95 L97 M98 M99 N100 G101 R102 N103 N104 L108 K109 R166 N169 F184 R185 N186 I187 T189 I190 H53 K61 R62 R73 N76 L78 M79 M80 N81 G82 R83 N84 N85 L89 K90 R147 N150 F165 R166 N167 I168 T170 I171
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
GO:0030490 maturation of SSU-rRNA
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP26783|RS5_YEAST Small ribosomal subunit protein uS7 (Gene Name=RPS5)

[Back to BioLiP]