Structure of PDB 6gzz Chain S4

Receptor sequence
>6gzzS4 (length=78) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQ
HVPVYITENMVGHKLGEFAPTRTYRGHG
3D structure
PDB6gzz Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainS4
Resolution4.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S4 K7 G8 F10 V11 D12 H14 K18 E21 W34 S35 R36 R37 Y52 G54 K55 K70 G72 T77 R78 T79 Y80 H83 K1 G2 F4 V5 D6 H8 K12 E15 W28 S29 R30 R31 Y46 G48 K49 K64 G66 T71 R72 T73 Y74 H77
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzz, PDBe:6gzz, PDBj:6gzz
PDBsum6gzz
PubMed30301898
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]