Structure of PDB 6gzx Chain S4

Receptor sequence
>6gzxS4 (length=78) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
KGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQ
HVPVYITENMVGHKLGEFAPTRTYRGHG
3D structure
PDB6gzx Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
ChainS4
Resolution4.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S4 K7 V9 H14 E17 K18 E21 W34 S35 R36 R37 K55 M66 H69 K70 R78 Y80 R81 G82 H83 G84 K1 V3 H8 E11 K12 E15 W28 S29 R30 R31 K49 M60 H63 K64 R72 Y74 R75 G76 H77 G78
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzx, PDBe:6gzx, PDBj:6gzx
PDBsum6gzx
PubMed30301898
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]