Structure of PDB 4u3m Chain S3

Receptor sequence
>4u3mS3 (length=223) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
ALISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRA
TRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKF
ADGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKAL
PDAVTIIEPKEEEPILAPSVKDY
3D structure
PDB4u3m ?
ChainS3
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna S3 L4 I5 S6 K7 K8 R9 G140 K141 R143 A145 R146 A147 K151 F156 I158 H159 S160 G161 Q162 H174 R178 Q179 V181 G183 K185 D204 L2 I3 S4 K5 K6 R7 G138 K139 R141 A143 R144 A145 K149 F154 I156 H157 S158 G159 Q160 H172 R176 Q177 V179 G181 K183 D202
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0070651 nonfunctional rRNA decay
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0030688 preribosome, small subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u3m, PDBe:4u3m, PDBj:4u3m
PDBsum4u3m
PubMed25209664
UniProtP05750|RS3_YEAST Small ribosomal subunit protein uS3 (Gene Name=RPS3)

[Back to BioLiP]