Structure of PDB 8wq2 Chain S28E |
>8wq2S28E (length=63) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] |
GFPAEVIQILDRTGVTGEVTQVRVRVLEGRDKGRILTRNVKGPVRLGDIL ILRETEREARKLS |
|
PDB | 8wq2 Structural basis of translation inhibition by a valine tRNA-derived fragment |
Chain | S28E |
Resolution | 4.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
S28E |
V33 T34 |
V15 T16 |
|
|
|
|