Structure of PDB 8wq4 Chain S27A

Receptor sequence
>8wq4S27A (length=54) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
QSKAVVRTYYEVEQDSIKLKNKKCPRCGSIMAHHMKPLERWACGKCGYTE
FIGK
3D structure
PDB8wq4 Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainS27A
Resolution4.53 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S27A K14 A15 V16 R18 Y21 E22 V23 E24 Q25 D26 K29 K31 N32 H44 M46 K3 A4 V5 R7 Y10 E11 V12 E13 Q14 D15 K18 K20 N21 H33 M35
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wq4, PDBe:8wq4, PDBj:8wq4
PDBsum8wq4
PubMed38599770
UniProtQ4JAG0|RS27A_SULAC Small ribosomal subunit protein eS31 (Gene Name=rps27ae)

[Back to BioLiP]