Structure of PDB 8hl4 Chain S27A

Receptor sequence
>8hl4S27A (length=54) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
QSKAVVRTYYEVEQDSIKLKNKKCPRCGSIMAHHMKPLERWACGKCGYTE
FIGK
3D structure
PDB8hl4 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainS27A
Resolution4.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S27A Q12 S13 K14 V16 V17 R18 T19 Y20 Y21 E22 V23 E24 Q25 D26 S27 I28 K29 K31 Q1 S2 K3 V5 V6 R7 T8 Y9 Y10 E11 V12 E13 Q14 D15 S16 I17 K18 K20
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl4, PDBe:8hl4, PDBj:8hl4
PDBsum8hl4
PubMed37604686
UniProtQ4JAG0|RS27A_SULAC Small ribosomal subunit protein eS31 (Gene Name=rps27ae)

[Back to BioLiP]