Structure of PDB 8hkz Chain S24E

Receptor sequence
>8hkzS24E (length=96) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
VSDKVEGIVERDIQNNVANRRELYIKLFHIGSGTPSRKELVKAIASTFST
AEDLVVVKKVFTNYGSGISYARVNVYKDKDSLQKLEPQYLIGRDTG
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainS24E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S24E H37 G39 S40 G41 T42 P43 S44 R45 K67 V68 T70 N71 Y72 G73 S74 G75 P95 Y97 H29 G31 S32 G33 T34 P35 S36 R37 K59 V60 T62 N63 Y64 G65 S66 G67 P87 Y89
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JAF9|RS24_SULAC Small ribosomal subunit protein eS24 (Gene Name=rps24e)

[Back to BioLiP]