Structure of PDB 8vs9 Chain S20

Receptor sequence

>8vs9S20 (length=85) Species: 562 (Escherichia coli) [Search protein sequence]

NIKSAKKRAIQSEKARKHNASRRSMMRTFIKKVYAAIEAGDKAAAQKAFN
EMQPIVDRQAAKGLIHKNKAARHKANLTAQINKLA

3D structure

PDB

8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.

Chain

S20

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S20	N2 K4 A6 R9 Q12 S13 K15 H19 N20 S22 R23 R24 S25 M26 T29 F30 K32 K33 Y35 Q54 P55 D58 R59 K63 H67 N69 K70 A72 R73 H74 K75 A76 T79 Q81	N1 K3 A5 R8 Q11 S12 K14 H18 N19 S21 R22 R23 S24 M25 T28 F29 K31 K32 Y34 Q53 P54 D57 R58 K62 H66 N68 K69 A71 R72 H73 K74 A75 T78 Q80

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links