Structure of PDB 6gzq Chain S2

Receptor sequence

>6gzqS2 (length=78) Species: 300852 (Thermus thermophilus HB8)

KGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYNGKQ
HVPVYITENMVGHKLGEFAPTRTYRGHG

3D structure

• PDB: 6gzq Cryo-EM structure of the hibernating Thermus thermophilus 100S ribosome reveals a protein-mediated dimerization mechanism.
• Chain: S2
• Resolution: 3.28 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S2	K7 D12 D13 H14 K18 W34 R37 Y52 G54 K55 K70 G72 E73 T77 R78 T79 Y80 H83	K1 D6 D7 H8 K12 W28 R31 Y46 G48 K49 K64 G66 E67 T71 R72 T73 Y74 H77

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit

External links

• PDB: RCSB:6gzq, PDBe:6gzq, PDBj:6gzq
• PDBsum: 6gzq
• PubMed: 30301898
• UniProt: Q5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)