Structure of PDB 3j77 Chain S2

Receptor sequence

>3j77S2 (length=217) Species: 4932 (Saccharomyces cerevisiae)

GWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNI
KPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAK
LSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPA
VKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQ
PLPVSPLDIYSDEASAQ

3D structure

• PDB: 3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.
• Chain: S2
• Resolution: 6.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S2	Q87 K88 Q89 T90 R91 G93 R95 K99 T159 K161 G163 S164 R168 I170 V179 A180 S181 Y197 T198 Q199 N201 K203 T204 R205 T206 E208 N209	Q54 K55 Q56 T57 R58 G60 R62 K66 T126 K128 G130 S131 R135 I137 V146 A147 S148 Y164 T165 Q166 N168 K170 T171 R172 T173 E175 N176

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0000054 ribosomal subunit export from nucleus
• GO:0002181 cytoplasmic translation
• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:0042254 ribosome biogenesis
• GO:0045903 positive regulation of translational fidelity

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:0032040 small-subunit processome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:3j77, PDBe:3j77, PDBj:3j77
• PDBsum: 3j77
• PubMed: 25043550
• UniProt: P25443|RS2_YEAST Small ribosomal subunit protein uS5 (Gene Name=RPS2)