Structure of PDB 3j6y Chain S2

Receptor sequence
>3j6yS2 (length=217) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence]
GWVPVTKLGRLVKAGKITTIEEIFLHSLPVKEFQIIDTLLPGLQDEVMNI
KPVQKQTRAGQRTRFKAVVVVGDSNGHVGLGIKTAKEVAGAIRAGIIIAK
LSVIPIRRGYWGTNLGQPHSLATKTTGKCGSVTVRLIPAPRGSGIVASPA
VKKLLQLAGVEDVYTQSNGKTRTLENTLKAAFVAIGNTYGFLTPNLWAEQ
PLPVSPLDIYSDEASAQ
3D structure
PDB3j6y Taura syndrome virus IRES initiates translation by binding its tRNA-mRNA-like structural element in the ribosomal decoding center.
ChainS2
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S2 Q87 K88 Q89 T90 R91 A92 K119 T159 K161 G163 S164 R168 V179 A180 S181 Y197 Q199 N201 K203 T204 R205 E208 N209 K212 Q54 K55 Q56 T57 R58 A59 K86 T126 K128 G130 S131 R135 V146 A147 S148 Y164 Q166 N168 K170 T171 R172 E175 N176 K179
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042254 ribosome biogenesis
GO:0045903 positive regulation of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:0032040 small-subunit processome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3j6y, PDBe:3j6y, PDBj:3j6y
PDBsum3j6y
PubMed24927574
UniProtP25443|RS2_YEAST Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]