Structure of PDB 8hkz Chain S19P

Receptor sequence
>8hkzS19P (length=115) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
WKKFRYRGKSLEDLLNMPMDEFIKLLPSRQRRSLKRGFSDKQRRLLEKIR
KISREGKQNKVIKTHVRNMVILPEMVGLRFAVYNGKEFVEFQVVPEMIGR
YLGEYSITTKKVEHG
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainS19P
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S19P P35 S36 R37 R39 S41 R44 G45 K49 K56 I70 K71 T72 H73 R75 N76 Y91 G93 K94 Y109 E112 S114 T116 T117 K119 V120 H122 P27 S28 R29 R31 S33 R36 G37 K41 K48 I62 K63 T64 H65 R67 N68 Y83 G85 K86 Y101 E104 S106 T108 T109 K111 V112 H114
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JB44|RS19_SULAC Small ribosomal subunit protein uS19 (Gene Name=rps19)

[Back to BioLiP]