Structure of PDB 8hl1 Chain S19E

Receptor sequence

>8hl1S19E (length=149) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

TVQMVPADILIPKLAEYLKNNVKELNPPNWVYFAKTASFKERVPDDIENW
WYIRAASLLRHLYIYKEPIGLQKTRKLYSGSKRRGTKPPRSVAPTHSIRT
ILQQLEKAGLVTKTRRGRILSPKGRSLLDKLAYEMFKELAEKKQDLKKY

3D structure

• PDB: 8hl1 Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
• Chain: S19E
• Resolution: 3.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S19E	W31 A38 I48 R55 S58 H62 L72 Q73 K74 Y79 K83 R84 P89 P90 R91 S92 V93 A95 P96 R101 Q105 R117 R118 G119 R120 R127 S128 D131 Y135 F138 K139 A142	W30 A37 I47 R54 S57 H61 L71 Q72 K73 Y78 K82 R83 P88 P89 R90 S91 V92 A93 P94 R99 Q103 R115 R116 G117 R118 R125 S126 D129 Y133 F136 K137 A140

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hl1, PDBe:8hl1, PDBj:8hl1
• PDBsum: 8hl1
• PubMed: 37604686
• UniProt: Q4J8U1