Structure of PDB 8hkz Chain S17P

Receptor sequence
>8hkzS17P (length=111) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
KKGQLVKNVGIEGVSAPSKTCDDEYCPYHGSLKVRGIVLEGKLIRARANR
TGTVEREYIFYDSKYKRYERRRSRIHVHIPSCLEVKEGDNVIIGESRPIA
KSISFVILGVK
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainS17P
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S17P L7 K9 N10 I13 K35 R37 G38 R47 R49 N51 R52 R58 Y60 F62 S65 K66 Y67 K68 R72 R73 R74 I77 R99 P100 I101 A102 K103 S104 F107 L5 K7 N8 I11 K33 R35 G36 R45 R47 N49 R50 R56 Y58 F60 S63 K64 Y65 K66 R70 R71 R72 I75 R97 P98 I99 A100 K101 S102 F105
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JB49|RS17_SULAC Small ribosomal subunit protein uS17 (Gene Name=rps17)

[Back to BioLiP]