Structure of PDB 8hkz Chain S17E

Receptor sequence
>8hkzS17E (length=62) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
GNVYTKDIKRVARELYDKFKDQASDKYDDNKKLVDEYVNVSSKKVKNRIA
GYLTRYVKISKN
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainS17E
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S17E G2 N3 V4 Y5 T6 K7 D8 K10 D26 Y28 D29 K32 K33 S43 K44 K45 N48 R49 G52 T55 R56 K59 G1 N2 V3 Y4 T5 K6 D7 K9 D25 Y27 D28 K31 K32 S42 K43 K44 N47 R48 G51 T54 R55 K58
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtQ4JAX5|RS17E_SULAC Small ribosomal subunit protein eS17 (Gene Name=rps17e)

[Back to BioLiP]