Structure of PDB 8vs9 Chain S17

Receptor sequence
>8vs9S17 (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainS17
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S17 K3 R5 S13 K15 M16 E17 S19 Y33 K35 F36 R39 T40 T41 K42 H44 E62 R64 P65 L66 S67 K68 T69 K70 S71 W72 K1 R3 S11 K13 M14 E15 S17 Y31 K33 F34 R37 T38 T39 K40 H42 E60 R62 P63 L64 S65 K66 T67 K68 S69 W70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum8vs9
PubMed38500588
UniProtC3SQY7

[Back to BioLiP]