Structure of PDB 8vsa Chain S16

Receptor sequence
>8vsaS16 (length=82) Species: 562 (Escherichia coli) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB8vsa Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainS16
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S16 M1 V2 R5 L6 R8 G10 A11 K12 K13 R14 F16 Y17 Q18 S24 R25 R28 G30 R31 F38 S44 K46 Q63 G64 R70 A73 E77 M1 V2 R5 L6 R8 G10 A11 K12 K13 R14 F16 Y17 Q18 S24 R25 R28 G30 R31 F38 S44 K46 Q63 G64 R70 A73 E77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vsa, PDBe:8vsa, PDBj:8vsa
PDBsum8vsa
PubMed38500588
UniProtC3SYP2

[Back to BioLiP]