Structure of PDB 8wq4 Chain S15P

Receptor sequence

>8wq4S15P (length=149) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

MNKKRAKGNSHSIRPVRSGPPKWVRFTREEVELLVEELAKRGYPPSMIGM
VLRDQYGVPLVKQITGRKLTAILQDRNMKPKIPEDLFNLMRRAVNIRRHL
FEYPKDKSAKRGLEEVESKIRRLASYYKETGKLPQEWSYDPAKAELLVT

3D structure

PDB

8wq4 Structural basis of translation inhibition by a valine tRNA-derived fragment

Chain

S15P

Resolution

4.53 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S15P	M1 N2 K3 K4 R5 K7 G8 N9 S10 H11 S12 I13 R14 R17 S46 G49 M50 R53 L60 K62 L69 T70 N88 L89 R91 R92 H99 Y103 D106 S108 A109 R111 K119 R122 L123 Y126	M1 N2 K3 K4 R5 K7 G8 N9 S10 H11 S12 I13 R14 R17 S46 G49 M50 R53 L60 K62 L69 T70 N88 L89 R91 R92 H99 Y103 D106 S108 A109 R111 K119 R122 L123 Y126

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8wq4, PDBe:8wq4, PDBj:8wq4
PDBsum	8wq4
PubMed	38599770
UniProt	Q4JAI3\|RS15_SULAC Small ribosomal subunit protein uS15 (Gene Name=rps15)

[Back to BioLiP]