Structure of PDB 8hl2 Chain S15P

Receptor sequence

>8hl2S15P (length=149) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

MNKKRAKGNSHSIRPVRSGPPKWVRFTREEVELLVEELAKRGYPPSMIGM
VLRDQYGVPLVKQITGRKLTAILQDRNMKPKIPEDLFNLMRRAVNIRRHL
FEYPKDKSAKRGLEEVESKIRRLASYYKETGKLPQEWSYDPAKAELLVT

3D structure

• PDB: 8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: S15P
• Resolution: 4.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S15P	K143 L146	K143 L146
BS02	rna	S15P	M1 N2 K3 K4 K7 G8 N9 S10 H11 S12 I13 R14 P45 S46 M47 M50 R53 K68 L69 T70 D85 R92 I96 H99 Y103 K105 D106 K107 R111 K119 R122 Y126	M1 N2 K3 K4 K7 G8 N9 S10 H11 S12 I13 R14 P45 S46 M47 M50 R53 K68 L69 T70 D85 R92 I96 H99 Y103 K105 D106 K107 R111 K119 R122 Y126

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
• PDBsum: 8hl2
• PubMed: 37604686
• UniProt: Q4JAI3|RS15_SULAC Small ribosomal subunit protein uS15 (Gene Name=rps15)