Structure of PDB 8vs9 Chain S14

Receptor sequence
>8vs9S14 (length=100) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainS14
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S14 A1 K2 Q3 S4 M5 R8 R12 D17 F20 K27 L47 Q48 R52 P56 S57 R58 R60 T66 R68 P69 H70 F72 R74 R80 I81 R84 K97 S99 W100 A1 K2 Q3 S4 M5 R8 R12 D17 F20 K27 L47 Q48 R52 P56 S57 R58 R60 T66 R68 P69 H70 F72 R74 R80 I81 R84 K97 S99 W100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum8vs9
PubMed38500588
UniProtA0A2X1PQW4

[Back to BioLiP]