Structure of PDB 8hkz Chain S13P

Receptor sequence

>8hkzS13P (length=147) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

QQQFKYIVRLFGQDVDGTMKLPYALAMIKGIGYNTAMIIIRKLNLDKDKR
LGEISDEDIKKIENLLNNKIIPESPNWIYNRQKDYESGADMHLVTSDLIF
YVRNDIERERRSRSWRGVRHSLGLKVRGQRTRTTGRTGATIGVRRAK

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

S13P

Resolution

4.78 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S13P	K22 Y25 M29 I30 G32 I33 G34 Y35 N36 T37 W79 I80 N82 R83 Q84 Y87 W117 R118 K127 R129 G130 Q131 R132 T133 R134 T136 G137 R138 T139 T142 I143 G144 V145	K20 Y23 M27 I28 G30 I31 G32 Y33 N34 T35 W77 I78 N80 R81 Q82 Y85 W115 R116 K125 R127 G128 Q129 R130 T131 R132 T134 G135 R136 T137 T140 I141 G142 V143

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	P39470\|RS13_SULAC Small ribosomal subunit protein uS13 (Gene Name=rps13)