Structure of PDB 8wkp Chain S12P

Receptor sequence

>8wkpS12P (length=143) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

GSKSPKGLFAARKLRLKRLKFSWSQRSFKRRMLALKEKFDPLEGAPMARG
IVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDE
VVIAGIGGTLGRSMGDLPGVRYKVVMVNGVSLDALYKGKKQKP

3D structure

PDB

8wkp Structural basis of translation inhibition by a valine tRNA-derived fragment

Chain

S12P

Resolution

4.62 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S12P	G3 K5 S6 P7 K8 G9 F11 R14 K15 K19 R20 F23 S24 W25 S26 Q27 R28 F30 K31 R33 M34 L37 F41 A47 P48 M49 R51 R63 Q64 P65 N66 S67 A68 V69 R70 V78 K79 A106 G107 L112 G113 R114 M116 D118 R123 K125 M128 S133 D135 A136 K139 K141	G1 K3 S4 P5 K6 G7 F9 R12 K13 K17 R18 F21 S22 W23 S24 Q25 R26 F28 K29 R31 M32 L35 F39 A45 P46 M47 R49 R61 Q62 P63 N64 S65 A66 V67 R68 V76 K77 A104 G105 L110 G111 R112 M114 D116 R121 K123 M126 S131 D133 A134 K137 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8wkp, PDBe:8wkp, PDBj:8wkp
PDBsum	8wkp
PubMed	38599770
UniProt	P11524\|RS12_SULAC Small ribosomal subunit protein uS12 (Gene Name=rps12)