Structure of PDB 8hl2 Chain S12P

Receptor sequence

>8hl2S12P (length=143) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

GSKSPKGLFAARKLRLKRLKFSWSQRSFKRRMLALKEKFDPLEGAPMARG
IVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDE
VVIAGIGGTLGRSMGDLPGVRYKVVMVNGVSLDALYKGKKQKP

3D structure

PDB

8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

S12P

Resolution

4.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S12P	G3 K5 P7 K8 G9 F11 R14 K15 R20 F23 S26 Q27 R28 R33 F41 D42 A47 P48 M49 R51 R63 N66 S67 R70 K71 K79 G90 D91 G109 G110 R114 M116 R123 S133 D135 K141	G1 K3 P5 K6 G7 F9 R12 K13 R18 F21 S24 Q25 R26 R31 F39 D40 A45 P46 M47 R49 R61 N64 S65 R68 K69 K77 G88 D89 G107 G108 R112 M114 R121 S131 D133 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum	8hl2
PubMed	37604686
UniProt	P11524\|RS12_SULAC Small ribosomal subunit protein uS12 (Gene Name=rps12)