Structure of PDB 8hkz Chain S12P

Receptor sequence

>8hkzS12P (length=143) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

GSKSPKGLFAARKLRLKRLKFSWSQRSFKRRMLALKEKFDPLEGAPMARG
IVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDE
VVIAGIGGTLGRSMGDLPGVRYKVVMVNGVSLDALYKGKKQKP

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

S12P

Resolution

4.78 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S12P	G3 K5 P7 K8 G9 F11 R14 R20 L21 F23 S24 S26 Q27 R33 F41 P48 M49 N66 S67 A68 V69 R70 K71 K79 F87 G90 D91 G110 R114 M116 G117 P120 G121 M128 S133 D135 K139 K141 K142	G1 K3 P5 K6 G7 F9 R12 R18 L19 F21 S22 S24 Q25 R31 F39 P46 M47 N64 S65 A66 V67 R68 K69 K77 F85 G88 D89 G108 R112 M114 G115 P118 G119 M126 S131 D133 K137 K139 K140

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	P11524\|RS12_SULAC Small ribosomal subunit protein uS12 (Gene Name=rps12)