Structure of PDB 6tbv Chain S121

Receptor sequence
>6tbvS121 (length=123) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA
3D structure
PDB6tbv Ornithine capture by a translating ribosome controls bacterial polyamine synthesis.
ChainS121
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034336 misfolded RNA binding
Biological Process
GO:0000372 Group I intron splicing
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0033120 positive regulation of RNA splicing
GO:0034337 RNA folding
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6tbv, PDBe:6tbv, PDBj:6tbv
PDBsum6tbv
PubMed32094585
UniProtP0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]