Structure of PDB 8hky Chain S11P

Receptor sequence
>8hkyS11P (length=128) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
REIRWGNARIYASQNNTIITITDITGAEIISKASGGMVVKADREKPSPYA
AMLAANKAANDAFDKGISAIHIKVRAQGGYGSKTPGPGAQPAIRALARAG
FIIGRIEDVTPLPHDTIRRPGGRRGRRV
3D structure
PDB8hky Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
ChainS11P
Resolution4.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S11P R13 Y15 N19 N20 G30 A31 S38 M41 D46 R47 L116 P117 H118 D119 I121 R122 P124 G125 R127 R128 R130 R131 V132 R9 Y11 N15 N16 G26 A27 S34 M37 D42 R43 L112 P113 H114 D115 I117 R118 P120 G121 R123 R124 R126 R127 V128
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hky, PDBe:8hky, PDBj:8hky
PDBsum8hky
PubMed37604686
UniProtP39469|RS11_SULAC Small ribosomal subunit protein uS11 (Gene Name=rps11)

[Back to BioLiP]