Structure of PDB 8vs9 Chain S11

Receptor sequence
>8vs9S11 (length=116) Species: 562 (Escherichia coli) [Search protein sequence]
RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRR
3D structure
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainS11
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S11 H21 N27 N28 I30 Q37 G38 N39 A40 W43 T45 G47 G48 R52 G53 S54 K56 K86 I115 P116 H117 N118 G119 C120 P123 K124 K125 R126 R127 H10 N16 N17 I19 Q26 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 I104 P105 H106 N107 G108 C109 P112 K113 K114 R115 R116
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum8vs9
PubMed38500588
UniProtB7MCR3|RS11_ECO45 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]