Structure of PDB 8wkp Chain S10P

Receptor sequence
>8wkpS10P (length=100) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
TKARIRLWSSNIDSLNFVVNQIRNMAQKTGIQVSGPIPLPTTRMEVPVMR
LPHGEGKKKWEHWEMKVHKRIIDIAADERVMRQLMRVRVPDDVYIEIELI
3D structure
PDB8wkp Structural basis of translation inhibition by a valine tRNA-derived fragment
ChainS10P
Resolution4.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S10P R6 I14 G37 P38 I39 P40 L41 T44 R45 M46 R52 L53 H55 G56 E57 G58 K59 K61 W62 H64 H70 I73 D75 E100 R4 I12 G35 P36 I37 P38 L39 T42 R43 M44 R50 L51 H53 G54 E55 G56 K57 K59 W60 H62 H68 I71 D73 E98
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wkp, PDBe:8wkp, PDBj:8wkp
PDBsum8wkp
PubMed38599770
UniProtP17199|RS10_SULAC Small ribosomal subunit protein uS10 (Gene Name=rps10)

[Back to BioLiP]