Structure of PDB 8vsa Chain S10

Receptor sequence

>8vsaS10 (length=98) Species: 562 (Escherichia coli)

RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL

3D structure

• PDB: 8vsa Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
• Chain: S10
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S10	R9 K11 H15 R37 P39 I40 P41 L42 P43 T44 R45 E47 I53 S54 P55 H56 N58 K59 R62 Q64 R68 H70 R72 D75	R5 K7 H11 R33 P35 I36 P37 L38 P39 T40 R41 E43 I49 S50 P51 H52 N54 K55 R58 Q60 R64 H66 R68 D71

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 09:00:18 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8vsa', asym_id = 'S10', title = 'Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8vsa', asym_id='S10', title='Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '8vsa', asym_id = 'S10'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='8vsa', asym_id='S10')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>