Structure of PDB 8vs9 Chain S10

Receptor sequence
>8vs9S10 (length=98) Species: 562 (Escherichia coli) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
ChainS10
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S10 R9 K11 H15 R37 P39 P41 L42 P43 T44 R45 K46 I53 S54 P55 H56 N58 K59 R62 R68 H70 R72 R5 K7 H11 R33 P35 P37 L38 P39 T40 R41 K42 I49 S50 P51 H52 N54 K55 R58 R64 H66 R68
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 07:43:25 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8vs9', asym_id = 'S10', title = 'Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8vs9', asym_id='S10', title='Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412', uniprot = '', pdbid = '8vs9', asym_id = 'S10'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412', uniprot='', pdbid='8vs9', asym_id='S10')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>