Structure of PDB 8b2l Chain S1

Receptor sequence

>8b2lS1 (length=132) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

ATREGELVFGVAHIFASFNDTFIHVTDLSGRETMVRITGGMKVKADRDES
SPYAAMLAAQDVSQRCKELGINALHIKLRATGGNKTKTPGPGAQSALRAL
ARSGMKIGRIEDVTPIPTDSTRRKGGRRGRRL

3D structure

PDB

8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S1	H31 N37 D38 F40 H42 G48 R49 E50 T51 R54 T56 G58 M59 D64 R65 R97 P133 I134 P135 T136 D137 T139 R140 K142 G143 R145 R146 R148 R149 L150	H13 N19 D20 F22 H24 G30 R31 E32 T33 R36 T38 G40 M41 D46 R47 R79 P115 I116 P117 T118 D119 T121 R122 K124 G125 R127 R128 R130 R131 L132

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links