Structure of PDB 5tcu Chain S1

Receptor sequence
>5tcuS1 (length=80) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
IRIRLKAYDHRVIDQSAEKIVETAKRSGADVSGPIPLPTEKSVYTIIRAV
HKYKDSREQFEQRTHKRLIDIVNPTPKTVD
3D structure
PDB5tcu Structural Basis for Linezolid Binding Site Rearrangement in the Staphylococcus aureus Ribosome.
ChainS1
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna S1 R9 H15 G38 P39 I40 L42 P43 T44 T50 R53 V55 H56 K57 Y58 R4 H10 G33 P34 I35 L37 P38 T39 T45 R48 V50 H51 K52 Y53
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tcu, PDBe:5tcu, PDBj:5tcu
PDBsum5tcu
PubMed28487427
UniProtQ2YYP5|RS10_STAAB Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]