Structure of PDB 3j77 Chain S1

Receptor sequence

>3j77S1 (length=214) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

VVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKSASDALKGRVVEVC
LADLQGSEDHSFRKIKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQT
LIEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVIS
EILTKEVQGSTLAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLK
QPKFDVGALMALHG

3D structure

PDB

3j77 Structures of Yeast 80S Ribosome-tRNA Complexes in the Rotated and Nonrotated Conformations.

Chain

Resolution

6.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S1	P23 V114 R115 K116 W117 Q118 R136 F138 N148 Q149 V150 K151 H153 Q157 S158 S159 R162 D203 I204 F205	P4 V95 R96 K97 W98 Q99 R117 F119 N129 Q130 V131 K132 H134 Q138 S139 S140 R143 D184 I185 F186
BS02	rna	S1	K222 F223 D224 V225 G226 A227 L228 M229	K203 F204 D205 V206 G207 A208 L209 M210

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:0030686	90S preribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j77, PDBe:3j77, PDBj:3j77
PDBsum	3j77
PubMed	25043550
UniProt	P33442\|RS3A1_YEAST Small ribosomal subunit protein eS1A (Gene Name=RPS1A)

[Back to BioLiP]