Structure of PDB 8vsa Chain S08

Receptor sequence

>8vsaS08 (length=129) Species: 562 (Escherichia coli)

SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKV
EGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGI
AVVSTSKGVMTDRAARQAGLGGEIICYVA

3D structure

• PDB: 8vsa Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
• Chain: S08
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S08	S1 M2 Q3 A7 R12 R14 N15 S29 K30 L31 K55 R79 P80 G81 R83 Y85 R87 K88 S104 T105 S106 G108 G119 G122 E123	S1 M2 Q3 A7 R12 R14 N15 S29 K30 L31 K55 R79 P80 G81 R83 Y85 R87 K88 S104 T105 S106 G108 G119 G122 E123

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 08:34:16 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8vsa', asym_id = 'S08', title = 'Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8vsa', asym_id='S08', title='Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '8vsa', asym_id = 'S08'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='8vsa', asym_id='S08')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>