Structure of PDB 8vsa Chain S05

Receptor sequence

>8vsaS05 (length=157) Species: 562 (Escherichia coli)

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEILG

3D structure

• PDB: 8vsa Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.
• Chain: S05
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S05	R19 F32 V55 P56	R11 F24 V47 P48
BS02	rna	S05	V20 S21 K22 T23 V24 R28 Y49 K51 R53 K61 T89 Q96 A98 S99 E100 G101 T102 A106 G107 R111 L123 A124 K125 A126 Y127 S129 T130 N131 I133 N134	V12 S13 K14 T15 V16 R20 Y41 K43 R45 K53 T81 Q88 A90 S91 E92 G93 T94 A98 G99 R103 L115 A116 K117 A118 Y119 S121 T122 N123 I125 N126

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8vsa, PDBe:8vsa, PDBj:8vsa
• PDBsum: 8vsa
• PubMed: 38500588
• UniProt: P0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)