Structure of PDB 8vs9 Chain S05

Receptor sequence

>8vs9S05 (length=157) Species: 562 (Escherichia coli) [Search protein sequence]

ELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAA
IQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASEGTGIIAGG
AMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPEMVAAKRGK
SVEEILG

3D structure

PDB

8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.

Chain

S05

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S05	V20 S21 K22 T23 V24 K25 R28 K51 R53 K61 T89 Q96 A98 S99 E100 G101 A106 G107 R111 L123 K125 A126 Y127 S129 N131 I133 N134	V12 S13 K14 T15 V16 K17 R20 K43 R45 K53 T81 Q88 A90 S91 E92 G93 A98 G99 R103 L115 K117 A118 Y119 S121 N123 I125 N126
BS02	rna	S05	L14 R19 V55 P56 I59	L6 R11 V47 P48 I51

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum	8vs9
PubMed	38500588
UniProt	P0A7W1\|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)

[Back to BioLiP]