Structure of PDB 8vsa Chain S04

Receptor sequence

>8vsaS04 (length=205) Species: 562 (Escherichia coli) [Search protein sequence]

ARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDY
GVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNV
VYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKK
QSRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIV
ELYSK

3D structure

PDB

8vsa Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.

Chain

S04

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S04	A1 R2 L4 P6 K7 L8 K9 R12 K21 V24 R25 K30 C31 K32 A36 G38 Q39 H40 S48 Y50 Q58 R61 L67 E68 R69 R80 K82 G83 T109 E112 Q115 S118 H119 K120 R127 V129 N130 I131 A132 S133 Y134 K147 S152 R153 S204 K205	A1 R2 L4 P6 K7 L8 K9 R12 K21 V24 R25 K30 C31 K32 A36 G38 Q39 H40 S48 Y50 Q58 R61 L67 E68 R69 R80 K82 G83 T109 E112 Q115 S118 H119 K120 R127 V129 N130 I131 A132 S133 Y134 K147 S152 R153 S204 K205

Gene Ontology

	Molecular Function
GO:0000900	mRNA regulatory element binding translation repressor activity
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0002181	cytoplasmic translation
GO:0006353	DNA-templated transcription termination
GO:0006412	translation
GO:0006417	regulation of translation
GO:0031564	transcription antitermination
GO:0042254	ribosome biogenesis
GO:0042274	ribosomal small subunit biogenesis
GO:0045947	negative regulation of translational initiation
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8vsa, PDBe:8vsa, PDBj:8vsa
PDBsum	8vsa
PubMed	38500588
UniProt	P0A7V8\|RS4_ECOLI Small ribosomal subunit protein uS4 (Gene Name=rpsD)

[Back to BioLiP]