Structure of PDB 8vs9 Chain S03

Receptor sequence

>8vs9S03 (length=206) Species: 562 (Escherichia coli) [Search protein sequence]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEI

3D structure

PDB

8vs9 Endogenous trans-translation structure visualizes the decoding of the first tmRNA alanine codon.

Chain

S03

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S03	G1 Q2 K3 V4 I13 K26 R155 E160 I161 A162 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 T190 T191 G193 V194 K198	G1 Q2 K3 V4 I13 K26 R155 E160 I161 A162 W166 R168 R171 V172 P173 L174 H175 T176 L177 R178 T190 T191 G193 V194 K198
BS02	rna	S03	R71 P72 G73 I76 K78 K79 G80 N101 I102 R106 Q122 R125 R130 R131 K134 R135 R142 R163	R71 P72 G73 I76 K78 K79 G80 N101 I102 R106 Q122 R125 R130 R131 K134 R135 R142 R163

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8vs9, PDBe:8vs9, PDBj:8vs9
PDBsum	8vs9
PubMed	38500588
UniProt	B7MCS9\|RS3_ECO45 Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]