Structure of PDB 8v84 Chain S

Receptor sequence

>8v84S (length=170) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]

HFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVK
KASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAA
VETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFPL
PHRVQKSTKTFSYKRPSTFY

3D structure

PDB

8v84 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	N65 H68 K71 S85 M90 Y91 K92 Q108 A111 A112 R113 R115 T132 R137 Y139 L144 K146 P153 H154 Q157 S159 K161 Y165 R167 S169 T170 F171	N63 H66 K69 S83 M88 Y89 K90 Q106 A109 A110 R111 R113 T130 R135 Y137 L142 K144 P151 H152 Q155 S157 K159 Y163 R165 S167 T168 F169

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v84, PDBe:8v84, PDBj:8v84
PDBsum	8v84
PubMed	38632236
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]