Structure of PDB 8uu8 Chain S

Receptor sequence

>8uu8S (length=118) Species: 1642 (Listeria innocua) [Search protein sequence]

PRVKGGTVTRKRRKKIVKLAKGYYGSKHLLFKVANQAVMKSYQYAYRDRR
QKKRDFRRLWIARINAAARMQDLSYSKLMHGLKLAGIDINRKMLADLAVN
DIASFNTLADSAKKALAK

3D structure

PDB

8uu8 Mechanistic insights into the alternative ribosome recycling by HflXr.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	P2 R3 V4 K5 T8 R11 R13 R14 K15 K19 K22 G23 Y24 Y25 L31 K33 Q37 K41 Y45 Y47 R48 D49 R50 R51 K54 R55 F57 R58 R59 I62 N66 R70 Y76 S77 H81 K84 N91 R92 K93	P1 R2 V3 K4 T7 R10 R12 R13 K14 K18 K21 G22 Y23 Y24 L30 K32 Q36 K40 Y44 Y46 R47 D48 R49 R50 K53 R54 F56 R57 R58 I61 N65 R69 Y75 S76 H80 K83 N90 R91 K92

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links