Structure of PDB 8urh Chain S

Receptor sequence

>8urhS (length=100) Species: 562 (Escherichia coli) [Search protein sequence]

AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW

3D structure

PDB

8urh Escherichia coli transcription-translation coupled complex class A (TTC-A) containing RfaH bound to ops signal, mRNA with a 21 nt long spacer, and fMet-tRNAs in E-site and P-site of the ribosome

Chain

Resolution

5.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	A2 K3 Q4 S5 M6 R9 R13 K19 R24 K28 L48 R53 S58 R59 R61 N62 R63 T67 R69 H71 G72 R75 R81 I82 R85 K98 S100 W101	A1 K2 Q3 S4 M5 R8 R12 K18 R23 K27 L47 R52 S57 R58 R60 N61 R62 T66 R68 H70 G71 R74 R80 I81 R84 K97 S99 W100

External links

PDB	RCSB:8urh, PDBe:8urh, PDBj:8urh
PDBsum	8urh
PubMed	39117885

[Back to BioLiP]