Structure of PDB 8rjb Chain S

Receptor sequence

>8rjbS (length=176) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

MKASGTLREYKVVGRCLPTPKCRTPPLYRMRIFAPNHVVAKSRFWYFVSQ
LKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDL
TTAGAVTQCYRDMGARHRARAHSIQIMKVEEIAASKCRRPAVKQFHDSKI
KFPLPHRVLRRQHKPRFTTKRPNTFF

3D structure

PDB

8rjb UCSF ChimeraX: Meeting modern challenges in visualization and analysis.

Chain

Resolution

2.69243 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	S	K2 A3 S4 G5 R23 Y63 Q66 F68 K70 P72 S86 R87 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 R120 A134 R139 F145 H146 D147 S148 P155 H156 R157 V158 R160 R161 H163 P165 R166 T168 T169 K170 R171 P172 N173 T174 F175 F176	K2 A3 S4 G5 R23 Y63 Q66 F68 K70 P72 S86 R87 M93 Y94 R95 R98 R111 G114 A115 R116 H117 R118 R120 A134 R139 F145 H146 D147 S148 P155 H156 R157 V158 R160 R161 H163 P165 R166 T168 T169 K170 R171 P172 N173 T174 F175 F176
BS02	rna	S	S42 R43 Y46 S49 K52 K53 K55 K56 S57 R87 H122	S42 R43 Y46 S49 K52 K53 K55 K56 S57 R87 H122

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rjb, PDBe:8rjb, PDBj:8rjb
PDBsum	8rjb
PubMed	38896445
UniProt	A0A287APR1

[Back to BioLiP]