Structure of PDB 8r08 Chain S

Receptor sequence
>8r08S (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
AIVFNATSEFCRTLGEIPEEPIVNRGLAAALLLCQNKGLLKDGYKPDVKI
EYVDETGRKLTPKEAFRQLSHRFHGKGSGKMKTERRMKKLDEEALLKKML
GTVALLQE
3D structure
PDB8r08 Structural insights into the cross-exon to cross-intron spliceosome switch
ChainS
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide S R732 F733 H734 R72 F73 H74
BS02 rna S S730 G739 M741 S70 G79 M81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0000481 maturation of 5S rRNA
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
GO:0045585 positive regulation of cytotoxic T cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8r08, PDBe:8r08, PDBj:8r08
PDBsum8r08
PubMed38778104
UniProtO43290|SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 (Gene Name=SART1)

[Back to BioLiP]